Lineage for d1vqnc1 (1vqn C:1-246)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1355944Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 1355945Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
    automatically mapped to Pfam PF00573
  5. 1355946Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 1355947Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 1355985Species Haloarcula marismortui [TaxId:2238] [52170] (42 PDB entries)
    Uniprot P12735
  8. 1355995Domain d1vqnc1: 1vqn C:1-246 [120335]
    Other proteins in same PDB: d1vqn11, d1vqn21, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqng1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1jj2c_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqnc1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (C:) 50S ribosomal protein L4E

SCOPe Domain Sequences for d1vqnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqnc1 c.22.1.1 (C:1-246) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOPe Domain Coordinates for d1vqnc1:

Click to download the PDB-style file with coordinates for d1vqnc1.
(The format of our PDB-style files is described here.)

Timeline for d1vqnc1: