SCOP 1.73: Domain d1vqna1: 1vqn A:91-237

Lineage for d1vqna1 (1vqn A:91-237)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)

8. Domain d1vqna1: 1vqn A:91-237 [120332]
   Other proteins in same PDB: d1vqn11, d1vqn31, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
   automatically matched to d1s72a1
   complexed with 1ma, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqna1

PDB Entry: 1vqn, 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d1vqna1:

Sequence; same for both SEQRES and ATOM records:

>d1vqna1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

Timeline for d1vqna1:

• d1vqna1 is new in SCOP 1.73
  
• d1vqna1 appears in SCOP 1.75
  
• d1vqna1 appears in the current release, SCOPe 2.08