Lineage for d1vqmy1 (1vqm Y:95-236)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980177Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 980232Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 980233Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 980234Protein Ribosomal protein L32e [52044] (1 species)
  7. 980235Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 980242Domain d1vqmy1: 1vqm Y:95-236 [120328]
    Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmz1
    automatically matched to d1jj2x_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po2, sr

Details for d1vqmy1

PDB Entry: 1vqm (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1vqmy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqmy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d1vqmy1:

Click to download the PDB-style file with coordinates for d1vqmy1.
(The format of our PDB-style files is described here.)

Timeline for d1vqmy1: