SCOPe 2.07: Domain d1vqmv1: 1vqm V:1-65

Lineage for d1vqmv1 (1vqm V:1-65)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)
   automatically mapped to Pfam PF00831

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
   Uniprot P10971

8. Domain d1vqmv1: 1vqm V:1-65 [120325]
   Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
   automatically matched to d1ffks_
   protein/RNA complex; complexed with cd, cl, k, mg, na, po2, sr

Details for d1vqmv1

PDB Entry: 1vqm, 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1vqmv1:

Sequence; same for both SEQRES and ATOM records:

>d1vqmv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1vqmv1:

• d1vqmv1 first appeared in SCOP 1.73
  
• d1vqmv1 appears in SCOPe 2.06
  
• d1vqmv1 appears in the current release, SCOPe 2.08