SCOPe 2.07: Domain d1vqmt1: 1vqm T:1-119

Lineage for d1vqmt1 (1vqm T:1-119)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries)
   Uniprot P10972

8. Domain d1vqmt1: 1vqm T:1-119 [120323]
   Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
   automatically matched to d1ffkq_
   protein/RNA complex; complexed with cd, cl, k, mg, na, po2, sr

Details for d1vqmt1

PDB Entry: 1vqm, 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (T:) 50S ribosomal protein L24P

SCOPe Domain Sequences for d1vqmt1:

Sequence; same for both SEQRES and ATOM records:

>d1vqmt1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1vqmt1:

• d1vqmt1 first appeared in SCOP 1.73
  
• d1vqmt1 appears in SCOPe 2.06
  
• d1vqmt1 appears in the current release, SCOPe 2.08