Lineage for d1vqmt1 (1vqm T:1-119)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946782Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 946783Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 946826Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 946866Species Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries)
    Uniprot P10972
  8. 946872Domain d1vqmt1: 1vqm T:1-119 [120323]
    Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
    automatically matched to d1ffkq_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po2, sr

Details for d1vqmt1

PDB Entry: 1vqm (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOPe Domain Sequences for d1vqmt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqmt1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d1vqmt1:

Click to download the PDB-style file with coordinates for d1vqmt1.
(The format of our PDB-style files is described here.)

Timeline for d1vqmt1: