| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) ![]() |
| Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
| Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (40 PDB entries) |
| Domain d1vqmp1: 1vqm P:1-143 [120319] Other proteins in same PDB: d1vqm11, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1 automatically matched to d1s72p_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3 |
PDB Entry: 1vqm (more details), 2.3 Å
SCOP Domain Sequences for d1vqmp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqmp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida
Timeline for d1vqmp1:
View in 3DDomains from other chains: (mouse over for more information) d1vqm11, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1 |