SCOP 1.73: Domain d1vqmo1: 1vqm O:1-115

Lineage for d1vqmo1 (1vqm O:1-115)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L18e [52084] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)

8. Domain d1vqmo1: 1vqm O:1-115 [120318]
   Other proteins in same PDB: d1vqm11, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
   automatically matched to d1ffkl_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqmo1

PDB Entry: 1vqm, 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (O:) 50S ribosomal protein L18e

SCOP Domain Sequences for d1vqmo1:

Sequence; same for both SEQRES and ATOM records:

>d1vqmo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

Timeline for d1vqmo1:

• d1vqmo1 is new in SCOP 1.73
  
• d1vqmo1 appears in SCOP 1.75
  
• d1vqmo1 appears in the current release, SCOPe 2.08