Lineage for d1vqml1 (1vqm L:1-150)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460348Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2460349Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2460350Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2460351Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 2460389Species Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)
    Uniprot P12737
  8. 2460395Domain d1vqml1: 1vqm L:1-150 [120315]
    Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
    automatically matched to d1ffkj_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po2, sr

Details for d1vqml1

PDB Entry: 1vqm (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (L:) 50S ribosomal protein L15P

SCOPe Domain Sequences for d1vqml1:

Sequence, based on SEQRES records: (download)

>d1vqml1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1vqml1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOPe Domain Coordinates for d1vqml1:

Click to download the PDB-style file with coordinates for d1vqml1.
(The format of our PDB-style files is described here.)

Timeline for d1vqml1: