SCOP 1.75: Domain d1vqmk1: 1vqm K:1-132

Lineage for d1vqmk1 (1vqm K:1-132)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
   Uniprot P22450

8. Domain d1vqmk1: 1vqm K:1-132 [120314]
   Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
   automatically matched to d1s72k_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqmk1

PDB Entry: 1vqm, 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (K:) 50S ribosomal protein L14P

SCOP Domain Sequences for d1vqmk1:

Sequence; same for both SEQRES and ATOM records:

>d1vqmk1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

Timeline for d1vqmk1:

• d1vqmk1 first appeared in SCOP 1.73
  
• d1vqmk1 appears in SCOPe 2.01
  
• d1vqmk1 appears in the current release, SCOPe 2.08