Lineage for d1vqmj1 (1vqm J:4-145)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691478Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 691479Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 691480Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 691481Protein Ribosomal protein L13 [52163] (2 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 691482Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries)
  8. 691503Domain d1vqmj1: 1vqm J:4-145 [120313]
    Other proteins in same PDB: d1vqm11, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmh1, d1vqmi1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
    automatically matched to d1ffkg_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqmj1

PDB Entry: 1vqm (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (J:) 50S ribosomal protein L13P

SCOP Domain Sequences for d1vqmj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqmj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1vqmj1:

Click to download the PDB-style file with coordinates for d1vqmj1.
(The format of our PDB-style files is described here.)

Timeline for d1vqmj1: