Lineage for d1vqmc1 (1vqm C:1-246)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982089Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 982090Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 982091Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 982092Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 982130Species Haloarcula marismortui [TaxId:2238] [52170] (46 PDB entries)
    Uniprot P12735
  8. 982136Domain d1vqmc1: 1vqm C:1-246 [120306]
    Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
    automatically matched to d1jj2c_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po2, sr

Details for d1vqmc1

PDB Entry: 1vqm (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (C:) 50S ribosomal protein L4E

SCOPe Domain Sequences for d1vqmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqmc1 c.22.1.1 (C:1-246) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOPe Domain Coordinates for d1vqmc1:

Click to download the PDB-style file with coordinates for d1vqmc1.
(The format of our PDB-style files is described here.)

Timeline for d1vqmc1: