SCOP 1.75: Domain d1vqma2: 1vqm A:1-90

Lineage for d1vqma2 (1vqm A:1-90)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
   Uniprot P20276
   includes the N-terminal tail

8. Domain d1vqma2: 1vqm A:1-90 [120304]
   Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
   automatically matched to d1s72a2
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqma2

PDB Entry: 1vqm, 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d1vqma2:

Sequence; same for both SEQRES and ATOM records:

>d1vqma2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

Timeline for d1vqma2:

• d1vqma2 first appeared in SCOP 1.73
  
• d1vqma2 appears in SCOPe 2.01
  
• d1vqma2 appears in the current release, SCOPe 2.08