| Class g: Small proteins [56992] (90 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) ![]() |
| Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein) |
| Protein Ribosomal protein L44e [57837] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries) Uniprot P32411 |
| Domain d1vqm31: 1vqm 3:1-92 [120302] Other proteins in same PDB: d1vqm11, d1vqm21, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1 automatically matched to d1ffkz_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3 |
PDB Entry: 1vqm (more details), 2.3 Å
SCOP Domain Sequences for d1vqm31:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqm31 g.41.8.3 (3:1-92) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe
Timeline for d1vqm31:
View in 3DDomains from other chains: (mouse over for more information) d1vqm11, d1vqm21, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1 |