Lineage for d1vqm11 (1vqm 1:1-56)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066475Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1066537Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
  6. 1066538Protein Ribosomal protein L37e [57834] (1 species)
  7. 1066539Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
    Uniprot P32410
  8. 1066545Domain d1vqm11: 1vqm 1:1-56 [120301]
    Other proteins in same PDB: d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
    automatically matched to d1ffkx_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po2, sr

Details for d1vqm11

PDB Entry: 1vqm (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d1vqm11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqm11 g.41.8.2 (1:1-56) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d1vqm11:

Click to download the PDB-style file with coordinates for d1vqm11.
(The format of our PDB-style files is described here.)

Timeline for d1vqm11: