Lineage for d1vqlu1 (1vql U:4-56)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262514Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
    automatically mapped to Pfam PF01246
  6. 2262515Protein Ribosomal protein L24e [57750] (1 species)
  7. 2262516Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 2262524Domain d1vqlu1: 1vql U:4-56 [120295]
    Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
    automatically matched to d1ffkr_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr, tse

Details for d1vqlu1

PDB Entry: 1vql (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d1vqlu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqlu1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d1vqlu1:

Click to download the PDB-style file with coordinates for d1vqlu1.
(The format of our PDB-style files is described here.)

Timeline for d1vqlu1: