SCOP 1.75: Domain d1vqls1: 1vql S:1-81

Lineage for d1vqls1 (1vql S:1-81)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (62 PDB entries)
   Uniprot P12732

8. Domain d1vqls1: 1vql S:1-81 [120293]
   Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
   automatically matched to d1jj2r_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, tse, ur3

Details for d1vqls1

PDB Entry: 1vql, 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (S:) 50S ribosomal protein L23P

SCOP Domain Sequences for d1vqls1:

Sequence; same for both SEQRES and ATOM records:

>d1vqls1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d1vqls1:

• d1vqls1 first appeared in SCOP 1.73
  
• d1vqls1 appears in SCOPe 2.01
  
• d1vqls1 appears in the current release, SCOPe 2.08