SCOP 1.75: Domain d1vqll1: 1vql L:1-150

Lineage for d1vqll1 (1vql L:1-150)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L15 (L15p) [52082] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)
   Uniprot P12737

8. Domain d1vqll1: 1vql L:1-150 [120286]
   Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
   automatically matched to d1ffkj_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, tse, ur3

Details for d1vqll1

PDB Entry: 1vql, 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (L:) 50S ribosomal protein L15P

SCOP Domain Sequences for d1vqll1:

Sequence, based on SEQRES records:

>d1vqll1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records):

>d1vqll1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

Timeline for d1vqll1:

• d1vqll1 first appeared in SCOP 1.73
  
• d1vqll1 appears in SCOPe 2.01
  
• d1vqll1 appears in the current release, SCOPe 2.08