Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) |
Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
Protein Ribosomal protein L15 (L15p) [52082] (2 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries) |
Domain d1vqll1: 1vql L:1-150 [120286] Other proteins in same PDB: d1vql11, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1 automatically matched to d1ffkj_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, tse, ur3 |
PDB Entry: 1vql (more details), 2.3 Å
SCOP Domain Sequences for d1vqll1:
Sequence, based on SEQRES records: (download)
>d1vqll1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]} tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl iaddfsegarekvegaggsveltdlgeerq
>d1vqll1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]} tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf segarekvegaggsveltdlgeerq
Timeline for d1vqll1:
View in 3D Domains from other chains: (mouse over for more information) d1vql11, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1 |