Lineage for d1vqlh1 (1vql H:1-163)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721795Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 721932Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 721933Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 721934Protein Ribosomal protein L10e [54688] (1 species)
  7. 721935Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (40 PDB entries)
  8. 721938Domain d1vqlh1: 1vql H:1-163 [120282]
    Other proteins in same PDB: d1vql11, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
    automatically matched to d1s72h_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, tse, ur3

Details for d1vqlh1

PDB Entry: 1vql (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (H:) 50S ribosomal protein L10e

SCOP Domain Sequences for d1vqlh1:

Sequence, based on SEQRES records: (download)

>d1vqlh1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri

Sequence, based on observed residues (ATOM records): (download)

>d1vqlh1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri

SCOP Domain Coordinates for d1vqlh1:

Click to download the PDB-style file with coordinates for d1vqlh1.
(The format of our PDB-style files is described here.)

Timeline for d1vqlh1: