Lineage for d1vqle1 (1vql E:1-79)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219397Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1219398Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 1219399Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1219400Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1219472Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 1219487Domain d1vqle1: 1vql E:1-79 [120279]
    Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
    automatically matched to d1ffk11
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr, tse

Details for d1vqle1

PDB Entry: 1vql (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOPe Domain Sequences for d1vqle1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqle1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOPe Domain Coordinates for d1vqle1:

Click to download the PDB-style file with coordinates for d1vqle1.
(The format of our PDB-style files is described here.)

Timeline for d1vqle1: