Lineage for d1vqld1 (1vql D:10-174)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200932Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2200933Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2200934Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 2200935Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 2200976Species Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
    Uniprot P14124
  8. 2200984Domain d1vqld1: 1vql D:10-174 [120278]
    Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
    automatically matched to d1ffkd_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr, tse

Details for d1vqld1

PDB Entry: 1vql (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d1vqld1:

Sequence, based on SEQRES records: (download)

>d1vqld1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1vqld1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOPe Domain Coordinates for d1vqld1:

Click to download the PDB-style file with coordinates for d1vqld1.
(The format of our PDB-style files is described here.)

Timeline for d1vqld1: