![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.77: Ribosomal protein L5 [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
![]() | Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) ![]() |
![]() | Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) |
![]() | Protein Ribosomal protein L5 [55284] (3 species) synonym: 50S ribosomal protein L5p, HMAL5, HL13 |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries) |
![]() | Domain d1vqld1: 1vql D:10-174 [120278] Other proteins in same PDB: d1vql11, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqle1, d1vqle2, d1vqlf1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1 automatically matched to d1ffkd_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, tse, ur3 |
PDB Entry: 1vql (more details), 2.3 Å
SCOP Domain Sequences for d1vqld1:
Sequence, based on SEQRES records: (download)
>d1vqld1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]} fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev
>d1vqld1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]} fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk hrlnpadavafiestydvev
Timeline for d1vqld1:
![]() Domains from other chains: (mouse over for more information) d1vql11, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqle1, d1vqle2, d1vqlf1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1 |