Lineage for d1vqlb1 (1vql B:1-337)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669499Superfamily b.43.3: Translation proteins [50447] (5 families) (S)
  5. 669648Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 669649Protein Ribosomal protein L3 [50462] (1 species)
    superfamily fold is elaborated with additional structures
  7. 669650Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (40 PDB entries)
  8. 669653Domain d1vqlb1: 1vql B:1-337 [120276]
    Other proteins in same PDB: d1vql11, d1vql31, d1vqla1, d1vqla2, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
    automatically matched to d1jj2b_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, tse, ur3

Details for d1vqlb1

PDB Entry: 1vql (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOP Domain Sequences for d1vqlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqlb1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Archaeon Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOP Domain Coordinates for d1vqlb1:

Click to download the PDB-style file with coordinates for d1vqlb1.
(The format of our PDB-style files is described here.)

Timeline for d1vqlb1: