![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
![]() | Protein C-terminal domain of ribosomal protein L2 [50115] (5 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries) Uniprot P20276 |
![]() | Domain d1vqla1: 1vql A:91-237 [120274] Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1 automatically matched to d1s72a1 protein/RNA complex; complexed with cd, cl, k, mg, na, sr, tse |
PDB Entry: 1vql (more details), 2.3 Å
SCOPe Domain Sequences for d1vqla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqla1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]} gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg kpksisrnappgrkvgdiaskrtgrgg
Timeline for d1vqla1:
![]() Domains from other chains: (mouse over for more information) d1vql11, d1vql21, d1vql31, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1 |