Lineage for d1vqla1 (1vql A:91-237)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796588Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 796751Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 796752Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 796753Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
    Uniprot P20276
  8. 796760Domain d1vqla1: 1vql A:91-237 [120274]
    Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
    automatically matched to d1s72a1
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, tse, ur3

Details for d1vqla1

PDB Entry: 1vql (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d1vqla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqla1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1vqla1:

Click to download the PDB-style file with coordinates for d1vqla1.
(The format of our PDB-style files is described here.)

Timeline for d1vqla1: