SCOP 1.73: Domain d1vql11: 1vql 1:1-56

Lineage for d1vql11 (1vql 1:1-56)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families)

5. Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)

6. Protein Ribosomal protein L37e [57834] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)

8. Domain d1vql11: 1vql 1:1-56 [120272]
   Other proteins in same PDB: d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
   automatically matched to d1ffkx_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, tse, ur3

Details for d1vql11

PDB Entry: 1vql, 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (1:) 50S ribosomal protein L37e

SCOP Domain Sequences for d1vql11:

Sequence; same for both SEQRES and ATOM records:

>d1vql11 g.41.8.2 (1:1-56) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

Timeline for d1vql11:

• d1vql11 is new in SCOP 1.73
  
• d1vql11 appears in SCOP 1.75
  
• d1vql11 appears in the current release, SCOPe 2.08