Lineage for d1vqkz1 (1vqk Z:10-82)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263551Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2263552Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 2263553Protein Ribosomal protein L37ae [57831] (1 species)
  7. 2263554Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 2263563Domain d1vqkz1: 1vqk Z:10-82 [120271]
    Other proteins in same PDB: d1vqk11, d1vqk21, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkg1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1
    automatically matched to d1s72z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqkz1

PDB Entry: 1vqk (more details), 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d1vqkz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqkz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

SCOPe Domain Coordinates for d1vqkz1:

Click to download the PDB-style file with coordinates for d1vqkz1.
(The format of our PDB-style files is described here.)

Timeline for d1vqkz1: