Lineage for d1vqkq1 (1vqk Q:1-95)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536931Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1536932Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 1536933Protein Ribosomal proteins L21e [50108] (1 species)
  7. 1536934Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
    Uniprot P12734
  8. 1536943Domain d1vqkq1: 1vqk Q:1-95 [120262]
    Other proteins in same PDB: d1vqk11, d1vqk21, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkg1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
    automatically matched to d1ffkn_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqkq1

PDB Entry: 1vqk (more details), 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d1vqkq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqkq1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d1vqkq1:

Click to download the PDB-style file with coordinates for d1vqkq1.
(The format of our PDB-style files is described here.)

Timeline for d1vqkq1: