SCOP 1.75: Domain d1vqkq1: 1vqk Q:1-95

Lineage for d1vqkq1 (1vqk Q:1-95)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L21e [50108] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
   Uniprot P12734

8. Domain d1vqkq1: 1vqk Q:1-95 [120262]
   Other proteins in same PDB: d1vqk11, d1vqk21, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkg1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
   automatically matched to d1ffkn_
   complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d1vqkq1

PDB Entry: 1vqk, 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui

PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOP Domain Sequences for d1vqkq1:

Sequence; same for both SEQRES and ATOM records:

>d1vqkq1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Archaeon Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

Timeline for d1vqkq1:

• d1vqkq1 first appeared in SCOP 1.73
  
• d1vqkq1 appears in SCOPe 2.01
  
• d1vqkq1 appears in the current release, SCOPe 2.08