Lineage for d1vq9i1 (1vq9 I:71-140)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308802Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2308803Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2308804Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2308852Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
    Uniprot P14122 67-136
  8. 2308864Domain d1vq9i1: 1vq9 I:71-140 [120225]
    Other proteins in same PDB: d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1
    automatically matched to d1s72i_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq9i1

PDB Entry: 1vq9 (more details), 2.4 Å

PDB Description: the structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d1vq9i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq9i1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

SCOPe Domain Coordinates for d1vq9i1:

Click to download the PDB-style file with coordinates for d1vq9i1.
(The format of our PDB-style files is described here.)

Timeline for d1vq9i1: