| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.77: RL5-like [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
Superfamily d.77.1: RL5-like [55282] (3 families) ![]() |
| Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) |
| Protein Ribosomal protein L5 [55284] (5 species) synonym: 50S ribosomal protein L5p, HMAL5, HL13 |
| Species Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries) Uniprot P14124 |
| Domain d1vq9d1: 1vq9 D:10-174 [120220] Other proteins in same PDB: d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1 automatically matched to d1ffkd_ protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr |
PDB Entry: 1vq9 (more details), 2.4 Å
SCOPe Domain Sequences for d1vq9d1:
Sequence, based on SEQRES records: (download)
>d1vq9d1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev
>d1vq9d1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev
Timeline for d1vq9d1:
View in 3DDomains from other chains: (mouse over for more information) d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1 |