Lineage for d1vq8z1 (1vq8 Z:10-82)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263551Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2263552Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 2263553Protein Ribosomal protein L37ae [57831] (1 species)
  7. 2263554Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 2263555Domain d1vq8z1: 1vq8 Z:10-82 [120213]
    Other proteins in same PDB: d1vq811, d1vq821, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8g1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1
    automatically matched to d1s72z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq8z1

PDB Entry: 1vq8 (more details), 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d1vq8z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq8z1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

SCOPe Domain Coordinates for d1vq8z1:

Click to download the PDB-style file with coordinates for d1vq8z1.
(The format of our PDB-style files is described here.)

Timeline for d1vq8z1: