Lineage for d1vq8w1 (1vq8 W:1-154)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864307Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 864308Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 864309Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 864310Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 864311Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
    Uniprot P14121
  8. 864313Domain d1vq8w1: 1vq8 W:1-154 [120210]
    Other proteins in same PDB: d1vq811, d1vq821, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8g1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8x1, d1vq8y1, d1vq8z1
    automatically matched to d1ffkt_
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3

Details for d1vq8w1

PDB Entry: 1vq8 (more details), 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOP Domain Sequences for d1vq8w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq8w1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOP Domain Coordinates for d1vq8w1:

Click to download the PDB-style file with coordinates for d1vq8w1.
(The format of our PDB-style files is described here.)

Timeline for d1vq8w1: