Lineage for d1vq8v1 (1vq8 V:1-65)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303233Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 2303234Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 2303235Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 2303276Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
    Uniprot P10971
  8. 2303277Domain d1vq8v1: 1vq8 V:1-65 [120209]
    Other proteins in same PDB: d1vq811, d1vq821, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8g1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1
    automatically matched to d1ffks_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq8v1

PDB Entry: 1vq8 (more details), 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1vq8v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq8v1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1vq8v1:

Click to download the PDB-style file with coordinates for d1vq8v1.
(The format of our PDB-style files is described here.)

Timeline for d1vq8v1: