SCOP 1.73: Domain d1vq8r1: 1vq8 R:1-150

Lineage for d1vq8r1 (1vq8 R:1-150)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (39 PDB entries)

8. Domain d1vq8r1: 1vq8 R:1-150 [120205]
   Other proteins in same PDB: d1vq811, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1
   automatically matched to d1ffko_
   complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3

Details for d1vq8r1

PDB Entry: 1vq8, 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (R:) 50S ribosomal protein L22P

SCOP Domain Sequences for d1vq8r1:

Sequence; same for both SEQRES and ATOM records:

>d1vq8r1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

Timeline for d1vq8r1:

• d1vq8r1 is new in SCOP 1.73
  
• d1vq8r1 appears in SCOP 1.75
  
• d1vq8r1 appears in the current release, SCOPe 2.08