Lineage for d1vq8n1 (1vq8 N:1-186)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495356Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2495357Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2495358Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 2495398Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
    Uniprot P14123
  8. 2495399Domain d1vq8n1: 1vq8 N:1-186 [120201]
    Other proteins in same PDB: d1vq811, d1vq821, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8g1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1
    automatically matched to d1ffkk_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq8n1

PDB Entry: 1vq8 (more details), 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (N:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d1vq8n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq8n1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOPe Domain Coordinates for d1vq8n1:

Click to download the PDB-style file with coordinates for d1vq8n1.
(The format of our PDB-style files is described here.)

Timeline for d1vq8n1: