Lineage for d1vq8l1 (1vq8 L:1-150)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460348Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2460349Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2460350Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2460351Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 2460389Species Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)
    Uniprot P12737
  8. 2460390Domain d1vq8l1: 1vq8 L:1-150 [120199]
    Other proteins in same PDB: d1vq811, d1vq821, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8g1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1
    automatically matched to d1ffkj_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq8l1

PDB Entry: 1vq8 (more details), 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (L:) 50S ribosomal protein L15P

SCOPe Domain Sequences for d1vq8l1:

Sequence, based on SEQRES records: (download)

>d1vq8l1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1vq8l1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOPe Domain Coordinates for d1vq8l1:

Click to download the PDB-style file with coordinates for d1vq8l1.
(The format of our PDB-style files is described here.)

Timeline for d1vq8l1: