Class b: All beta proteins [48724] (165 folds) |
Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) |
Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
Protein Ribosomal protein L14 [50195] (3 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (40 PDB entries) |
Domain d1vq8k1: 1vq8 K:1-132 [120198] Other proteins in same PDB: d1vq811, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1 automatically matched to d1s72k_ complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3 |
PDB Entry: 1vq8 (more details), 2.2 Å
SCOP Domain Sequences for d1vq8k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq8k1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]} mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr fgsvasaatmiv
Timeline for d1vq8k1:
View in 3D Domains from other chains: (mouse over for more information) d1vq811, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1 |