Lineage for d1vq8k1 (1vq8 K:1-132)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667238Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 667239Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 667240Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 667241Protein Ribosomal protein L14 [50195] (3 species)
  7. 667242Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (40 PDB entries)
  8. 667246Domain d1vq8k1: 1vq8 K:1-132 [120198]
    Other proteins in same PDB: d1vq811, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1
    automatically matched to d1s72k_
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3

Details for d1vq8k1

PDB Entry: 1vq8 (more details), 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOP Domain Sequences for d1vq8k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq8k1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1vq8k1:

Click to download the PDB-style file with coordinates for d1vq8k1.
(The format of our PDB-style files is described here.)

Timeline for d1vq8k1: