Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) |
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
Protein Ribosomal protein L11, C-terminal domain [46908] (3 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [109705] (22 PDB entries) |
Domain d1vq8i1: 1vq8 I:71-140 [120196] Other proteins in same PDB: d1vq811, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8h1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1 automatically matched to d1s72i_ complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3 |
PDB Entry: 1vq8 (more details), 2.2 Å
SCOP Domain Sequences for d1vq8i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq8i1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]} gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg tctslgvtie
Timeline for d1vq8i1:
View in 3D Domains from other chains: (mouse over for more information) d1vq811, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8h1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1 |