SCOP 1.73: Domain d1vq7y1: 1vq7 Y:95-236

Lineage for d1vq7y1 (1vq7 Y:95-236)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (40 PDB entries)

8. Domain d1vq7y1: 1vq7 Y:95-236 [120183]
   Other proteins in same PDB: d1vq711, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7z1
   automatically matched to d1jj2x_
   complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, pae, psu, ur3

Details for d1vq7y1

PDB Entry: 1vq7, 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOP Domain Sequences for d1vq7y1:

Sequence; same for both SEQRES and ATOM records:

>d1vq7y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d1vq7y1:

• d1vq7y1 is new in SCOP 1.73
  
• d1vq7y1 appears in SCOP 1.75
  
• d1vq7y1 appears in the current release, SCOPe 2.08