Lineage for d1vq7x1 (1vq7 X:7-88)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023152Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 1023153Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 1023154Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 1023155Protein Ribosomal protein L31e [54577] (1 species)
  7. 1023156Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 1023169Domain d1vq7x1: 1vq7 X:7-88 [120182]
    Other proteins in same PDB: d1vq711, d1vq721, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7g1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7y1, d1vq7z1
    automatically matched to d1ffku_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq7x1

PDB Entry: 1vq7 (more details), 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1vq7x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq7x1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1vq7x1:

Click to download the PDB-style file with coordinates for d1vq7x1.
(The format of our PDB-style files is described here.)

Timeline for d1vq7x1: