Lineage for d1vq7v1 (1vq7 V:1-65)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1077399Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1077416Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 1077417Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1077418Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1077459Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
    Uniprot P10971
  8. 1077472Domain d1vq7v1: 1vq7 V:1-65 [120180]
    Other proteins in same PDB: d1vq711, d1vq721, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7g1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
    automatically matched to d1ffks_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq7v1

PDB Entry: 1vq7 (more details), 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1vq7v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq7v1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1vq7v1:

Click to download the PDB-style file with coordinates for d1vq7v1.
(The format of our PDB-style files is described here.)

Timeline for d1vq7v1: