![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) ![]() |
![]() | Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein) |
![]() | Protein Ribosomal protein L24e [57750] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries) |
![]() | Domain d1vq7u1: 1vq7 U:4-56 [120179] Other proteins in same PDB: d1vq711, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1 automatically matched to d1ffkr_ complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, pae, psu, ur3 |
PDB Entry: 1vq7 (more details), 2.5 Å
SCOP Domain Sequences for d1vq7u1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq7u1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]} recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
Timeline for d1vq7u1:
![]() Domains from other chains: (mouse over for more information) d1vq711, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1 |