SCOP 1.73: Domain d1vq7t1: 1vq7 T:1-119

Lineage for d1vq7t1 (1vq7 T:1-119)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries)

8. Domain d1vq7t1: 1vq7 T:1-119 [120178]
   Other proteins in same PDB: d1vq711, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
   automatically matched to d1ffkq_
   complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, pae, psu, ur3

Details for d1vq7t1

PDB Entry: 1vq7, 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (T:) 50S ribosomal protein L24P

SCOP Domain Sequences for d1vq7t1:

Sequence; same for both SEQRES and ATOM records:

>d1vq7t1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1vq7t1:

• d1vq7t1 is new in SCOP 1.73
  
• d1vq7t1 appears in SCOP 1.75
  
• d1vq7t1 appears in the current release, SCOPe 2.08