Lineage for d1vq7p1 (1vq7 P:1-143)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645350Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 645351Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 645352Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 645353Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 645354Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (40 PDB entries)
  8. 645383Domain d1vq7p1: 1vq7 P:1-143 [120174]
    Other proteins in same PDB: d1vq711, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
    automatically matched to d1s72p_
    complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, pae, psu, ur3

Details for d1vq7p1

PDB Entry: 1vq7 (more details), 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOP Domain Sequences for d1vq7p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq7p1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1vq7p1:

Click to download the PDB-style file with coordinates for d1vq7p1.
(The format of our PDB-style files is described here.)

Timeline for d1vq7p1: