Lineage for d1vq7n1 (1vq7 N:1-186)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 702503Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 702504Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 702505Protein Ribosomal protein L18 (L18p) [53139] (3 species)
  7. 702506Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
  8. 702535Domain d1vq7n1: 1vq7 N:1-186 [120172]
    Other proteins in same PDB: d1vq711, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
    automatically matched to d1ffkk_
    complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, pae, psu, ur3

Details for d1vq7n1

PDB Entry: 1vq7 (more details), 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (N:) 50S ribosomal protein L18P

SCOP Domain Sequences for d1vq7n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq7n1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1vq7n1:

Click to download the PDB-style file with coordinates for d1vq7n1.
(The format of our PDB-style files is described here.)

Timeline for d1vq7n1: