Lineage for d1vq7j1 (1vq7 J:4-145)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837505Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 1837506Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 1837507Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 1837508Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 1837546Species Haloarcula marismortui [TaxId:2238] [52164] (40 PDB entries)
    Uniprot P29198
  8. 1837559Domain d1vq7j1: 1vq7 J:4-145 [120168]
    Other proteins in same PDB: d1vq711, d1vq721, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7g1, d1vq7h1, d1vq7i1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
    automatically matched to d1ffkg_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq7j1

PDB Entry: 1vq7 (more details), 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (J:) 50S ribosomal protein L13P

SCOPe Domain Sequences for d1vq7j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq7j1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOPe Domain Coordinates for d1vq7j1:

Click to download the PDB-style file with coordinates for d1vq7j1.
(The format of our PDB-style files is described here.)

Timeline for d1vq7j1: