SCOP 1.73: Domain d1vq7i1: 1vq7 I:71-140

Lineage for d1vq7i1 (1vq7 I:71-140)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (3 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [109705] (22 PDB entries)

8. Domain d1vq7i1: 1vq7 I:71-140 [120167]
   Other proteins in same PDB: d1vq711, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7h1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
   automatically matched to d1s72i_
   complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, pae, psu, ur3

Details for d1vq7i1

PDB Entry: 1vq7, 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (I:) 50S ribosomal protein L11P

SCOP Domain Sequences for d1vq7i1:

Sequence; same for both SEQRES and ATOM records:

>d1vq7i1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

Timeline for d1vq7i1:

• d1vq7i1 is new in SCOP 1.73
  
• d1vq7i1 appears in SCOP 1.75
  
• d1vq7i1 appears in the current release, SCOPe 2.08