Lineage for d1vq7e2 (1vq7 E:80-172)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928241Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1928242Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 1928243Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1928244Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1928316Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 1928342Domain d1vq7e2: 1vq7 E:80-172 [120164]
    Other proteins in same PDB: d1vq711, d1vq721, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7f1, d1vq7g1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
    automatically matched to d1ffk12
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq7e2

PDB Entry: 1vq7 (more details), 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOPe Domain Sequences for d1vq7e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq7e2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

SCOPe Domain Coordinates for d1vq7e2:

Click to download the PDB-style file with coordinates for d1vq7e2.
(The format of our PDB-style files is described here.)

Timeline for d1vq7e2: